PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.368410.1
Common NameCsa_5G209490, LOC101207929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 269aa    MW: 29409.6 Da    PI: 6.6317
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.368410.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.3e-192873147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+q+G+++W++I+  ++ gR++k+c++rw + 
   Cucsa.368410.1 28 KGSWSPQEDATLIKLVEQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 73
                     799*****************************.***********985 PP

2Myb_DNA-binding54.33.1e-1782124347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed l+++a++ +G++ W+tIar ++ gRt++ +k++w++ 
   Cucsa.368410.1  82 PFTPAEDALILQAHAVHGNK-WSTIARSLP-GRTDNAIKNHWNST 124
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.6742378IPR017930Myb domain
SuperFamilySSF466899.73E-3125121IPR009057Homeodomain-like
SMARTSM007175.6E-162776IPR001005SANT/Myb domain
PfamPF002491.7E-182873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-252981IPR009057Homeodomain-like
CDDcd001672.29E-143072No hitNo description
SMARTSM007171.3E-1479127IPR001005SANT/Myb domain
PROSITE profilePS5129421.46879129IPR017930Myb domain
PfamPF002491.2E-1482124IPR001005SANT/Myb domain
CDDcd001671.43E-1182125No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2382128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MVLIGIALPN HNNNTNSNNN NNNHNRVKGS WSPQEDATLI KLVEQHGPRN WSLISTGIPG  60
RSGKSCRLRW CNQLSPTVQH RPFTPAEDAL ILQAHAVHGN KWSTIARSLP GRTDNAIKNH  120
WNSTLRRRRD ADLSSASDDD DNDDDDSEAS LKRTCFDRNS VGGGEPETSL RLSLPGEVVV  180
AAEMDVKVKE EVTVESEKND GRRRVVAAAE EEKGNRKKEV DESCLATIMQ RMIAQEVRNY  240
IDSLRARGGL GIGPGVGPGL DPAAQETP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-36271283104MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-362712857158MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-362712857158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-36271283104C-Myb DNA-Binding Domain
1msf_C1e-36271283104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819050.0LN681905.1 Cucumis melo genomic scaffold, anchoredscaffold00033.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148201.11e-159PREDICTED: transcription factor MYB44-like
TrEMBLA0A0A0KQJ21e-159A0A0A0KQJ2_CUCSA; Uncharacterized protein
STRINGVIT_13s0067g01360.t019e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-49myb domain protein 73
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]